Invitrogen™ Human HDBP2 (aa 284-334) Control Fragment Recombinant Protein

Product Code. 30212669

Brand: Invitrogen™ RP109547

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139942 (PA5-139942. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Papillomavirus Regulatory Factor 1/HDBP2 is a novel transcription factor shuttling between nucleus and cytoplasm and binds to the specific GCCGGCG, which is an essential cis-element for Huntington's disease gene expression.

Specifications

• Accession Number: Q9H8N7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55893
• Name: Human HDBP2 (aa 284-334) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC053701; Gm910; HD gene regulatory region-binding protein 2; HDBP2; HDBP-2; HD-regulating factor 2; HDRF-2; Huntington disease gene regulatory region-binding protein 2; Huntington's disease gene regulatory region-binding protein 2; papillomavirus regulatory factor; papillomavirus regulatory factor 1; papillomavirus regulatory factor PRF-1; papillomavirus-binding factor; PBF; PRF1; PRF-1; Si-1-8-14; Zfp395; Zinc finger protein 395; ZNF395
• Common Name: HDBP2
• Gene Symbol: ZNF395
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining