missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HCC1 (aa 412-523) Control Fragment Recombinant Protein

Product Code. 30199457
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199457

Brand: Invitrogen™ RP92133

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14498
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9584
Name Human HCC1 (aa 412-523) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500012C14Rik; 2310040E03Rik; B330012G18Rik; C79248; CAPER; CAPER alpha; CAPERalpha; Coactivator of activating protein 1 and estrogen receptors; coactivator of activating protein-1 and estrogen receptors; coactivator of AP-1 and ERs; FSAP59; functional spliceosome-associated protein 59; HCC1; Hepatocellular carcinoma protein 1; R75070; RBM39; RNA binding motif protein 39; RNA-binding motif protein 39; RNA-binding protein 39; RNA-binding region (RNP1, RRM) containing 2; RNA-binding region-containing 2; RNA-binding region-containing protein 2; Rnp1; Rnpc2; Rrm; Splicing factor HCC1; transcription coactivator CAPER
Common Name HCC1
Gene Symbol RBM39
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.