missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HAUS6 (aa 729-831) Control Fragment Recombinant Protein

Product Code. 30210974
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210974

Brand: Invitrogen™ RP92990

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54288 (PA5-54288. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HAUS6 is 1 of 8 subunits of the 390-kDa human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb augmentare, meaning to increase. The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 ; Uehara et al., 2009 ).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z4H7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54801
Name Human HAUS6 (aa 729-831) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6230416J20Rik; 9830144E06; D4Ertd27e; Dgt6; dim gamma-tubulin homolog; FAM29A; family with sequence similarity 29, member A; HAUS augmin like complex subunit 6; HAUS augmin-like complex subunit 6; HAUS augmin-like complex, subunit 6; Haus6; KIAA1574; likely ortholog of H. sapiens family with sequence similarity 29, member A (FAM29A); mKIAA1574
Common Name HAUS6
Gene Symbol HAUS6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.