Invitrogen™ Human HAUS3 (aa 226-322) Control Fragment Recombinant Protein

Product Code. 30206670

Brand: Invitrogen™ RP105991

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65275 (PA5-65275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.

Specifications

• Accession Number: Q68CZ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79441
• Name: Human HAUS3 (aa 226-322) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C4orf15; D4S43h; D5H4S43; D5H4S43E; dgt3; HAUS augmin like complex subunit 3; HAUS augmin-like complex subunit 3; HAUS augmin-like complex, subunit 3; HAUS3; IT1
• Common Name: HAUS3
• Gene Symbol: HAUS3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining