missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194176

Invitrogen™ Human Haptoglobin (aa 150-226) Control Fragment Recombinant Protein

Product Code. 30194176
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194176

Brand: Invitrogen™ RP100537

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Haptoglobin is an a2-globulin plasma protein synthesized in the liver. It is an acute phase protein which also acts as a scavenger of hemoglobin from hemolyzed red cells. The haptoglobin monomer consists of two a and two beta chains; the a chains bay be hp1Fa, hp1Sa, or hp2a types while the beta chain is constant. Three major phenotypes are recognized: HP1-1, Hp2-1 and Hp-2-2, in which the hp1a chain bay be either the F or S type.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00738
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3240
Name Human Haptoglobin (aa 150-226) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha polypeptide; Ba1-647; beta polypeptide; binding peptide; Binding peptide (BP); BP; haptoglobin; haptoglobin alpha 1 S; Haptoglobin alpha chain; Haptoglobin alpha chain / alpha(1 S) beta; haptoglobin alpha(1 S)-beta; Haptoglobin alpha(2 FS) beta; haptoglobin alpha(2 FS)-beta; Haptoglobin beta chain; haptoglobin, alpha polypeptide; haptoglobin, beta polypeptide; haptoglobin; haptoglobin-like; haptoglobin-like; haptoglobin-related protein; Hp; HP-1; HP2 ALPHA2; HP2ALPHA2; HP2-ALPHA-2; HPA1S; HPR; HPT; Liver regeneration-related protein LRRG173; LOC100067869; LOC479668; MGC111141; MGC133752; preHP2; zonulin
Common Name Haptoglobin
Gene Symbol HP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.