Invitrogen™ Human HAGH (aa 189-245) Control Fragment Recombinant Protein

Product Code. 30194459

Brand: Invitrogen™ RP103393

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84481 (PA5-84481. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The enzyme encoded by the HAGH gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. Three transcript variants encoding different isoforms have been found for this gene. Diseases associated with HAGH include Hydroxyacyl Glutathione Hydrolase Deficiency.

Specifications

• Accession Number: Q16775
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3029
• Name: Human HAGH (aa 189-245) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC019817; GLO2; Glo-2; Glx II; GLX2; GLXII; Glyoxalase II; glyoxylase 2; HAGH; HAGH1; hydroxyacyl glutathione hydrolase; hydroxyacylglutathione hydrolase; hydroxyacylglutathione hydrolase, mitochondrial; hydroxyacylglutathione hydroxylase; round spermatid protein RSP29; Rsp29
• Common Name: HAGH
• Gene Symbol: HAGH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining