Invitrogen™ Human H6PD (aa 537-653) Control Fragment Recombinant Protein

Product Code. 30208439

Brand: Invitrogen™ RP102368

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52142 (PA5-52142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.

Specifications

• Accession Number: O95479
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9563
• Name: Human H6PD (aa 537-653) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6 PGL; 6-phosphogluconolactonase; AI785303; CORTRD1; EGK_00198; G6PD, H form; G6pd1; G6PDH; GDH; GDH/6 PGL endoplasmic bifunctional protein; glucose 1- dehydrogenase; glucose 1-dehydrogenase; glucose dehydrogenase; glucose dehyrogenase; Glucose-6-phosphate dehydrogenase; glucose-6-phosphate dehydrogenase 1; glucose-6-phosphate dehydrogenase, salivary; Gpd1; Gpd-1; H6pd; H6pdh; hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase); hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase
• Common Name: H6PD
• Gene Symbol: H6PD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: APMPSDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining