Invitrogen™ Human GYS2 (aa 642-703) Control Fragment Recombinant Protein

Product Code. 30182089

Brand: Invitrogen™ RP97710

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58806 (PA5-58806. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis of glycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule. Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fasting hypoglycemia with decreased liver glycogen content.

Specifications

• Accession Number: P54840
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2998
• Name: Human GYS2 (aa 642-703) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC021322; cb765; Glycogen [starch] synthase, liver; glycogen liver; glycogen synthase; glycogen synthase 2; glycogen synthase 2 (liver); glycogen synthase, liver; GLYSN; GYS2; LGS; zgc:112057
• Common Name: GYS2
• Gene Symbol: GYS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining