Invitrogen™ Human GYG2 (aa 232-369) Control Fragment Recombinant Protein

Product Code. 30200889

Brand: Invitrogen™ RP92165

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52156 (PA5-52156. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GYG2 belongs to the glycogenin family. Glycogenin is a self-glycosylating protein involved in the initiation phase of glycogen biosynthesis. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, including the predominant band around 66kDa and a light band around 45kDa.

Specifications

• Accession Number: O15488
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8908
• Name: Human GYG2 (aa 232-369) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: glycogenin 2; glycogenin glucosyltransferase; glycogenin-2; GN2; GN-2; GYG2
• Common Name: GYG2
• Gene Symbol: GYG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining