missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202140

Invitrogen™ Human GULP1 (aa 105-201) Control Fragment Recombinant Protein

Product Code. 30202140
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202140

Brand: Invitrogen™ RP92051

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54240 (PA5-54240. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, inflammation, and autoimmunity. CED6 is an evolutionarily conserved adaptor protein required for efficient engulfment of apoptotic cells by phagocytes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UBP9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51454
Name Human GULP1 (aa 105-201) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110030A04Rik; 5730529O06Rik; CED 6; Ced6; CED-6; CED-6 protein; Cell death protein 6 homolog; engulfment adapter protein; FLJ31156; GULP; GULP, engulfment adaptor PTB domain containing 1; GULP1; Gulp-2; OTTHUMP00000205908; OTTHUMP00000205909; OTTHUMP00000205911; Protein GULP; PTB domain adapter protein CED-6; PTB domain adaptor protein CED-6; PTB domain-containing engulfment adapter protein 1
Common Name GULP1
Gene Symbol GULP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.