Invitrogen™ Human GUCY1B3 (aa 208-333) Control Fragment Recombinant Protein

Product Code. 30196006

Brand: Invitrogen™ RP109717

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145172 (PA5-145172. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Guanylate cyclases belong to the adenylyl cyclase class-4/guanylyl cyclase family. There are two forms of guanylate cyclase, a soluble form (GCS or sGC), which act as receptors for nitric oxide and a membrane-bound receptor form (GC), which are peptide hormone receptors. The GC-C protein is composed of an extracellular domain, a single transmembrane domain, and a cytoplasmic region consisting of a kinase-like domain and a catalytic domain. It is expressed as two differentially glycosylated forms, a 130 kDa precursor form present in the endoplasmic reticulum and a 145 kDa form present on the plasma membrane. Ligand binding to the extracellular domain of GC-C promotes the accumulation of cGMP. GC-C acts as the receptor for heatstable enterotoxins, small peptides secreted by some pathogenic strains of E. coli that cause severe secretory diarrhea. GC-C also binds to guanylin and uroguanylin peptides, which modulate renal function in response to oral salt load.

Specifications

• Accession Number: Q02153
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2983
• Name: Human GUCY1B3 (aa 208-333) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: beta 1 sGC; GCbeta1; GCS beta1; GCS beta3; GC-SB3; GCSbeta1; GC-S-beta-1; GCS-beta1; GCS-beta-1; GCSbeta3; GCS-beta3; GCS-beta-3; guanylate cyclase 1 soluble subunit beta; guanylate cyclase 1 soluble subunit beta 1; guanylate cyclase 1, soluble, beta 3; guanylate cyclase 70 kDa subunit; guanylate cyclase soluble subunit beta-1; Guanylate cyclase soluble subunit beta-3; guanylate cyclase, soluble, beta 1; GUC1B3; GUCB3; GUCSB3; Gucy1b1; Gucy1b3; nitric oxide-sensitive guanylyl cyclase beta 1 subunit; NO-sensitive GC beta 1 subunit; NO-sensitive guanylyl cyclase beta 1 subunit; SGC; sgc1b1; si:ch73-34b5.3; soluble guanylate cyclase 1 beta 3; soluble guanylate cyclase beta-1 subunit; soluble guanylate cyclase small subunit; soluble guanylate cyclase small subunit beta 1; soluble guanylyl cyclase beta1 subunit
• Common Name: GUCY1B3
• Gene Symbol: GUCY1B1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining