missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GUCY1A3 (aa 237-306) Control Fragment Recombinant Protein

Product Code. 30210326
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210326

Brand: Invitrogen™ RP108431

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Guanylate cyclases belong to the adenylyl cyclase class-4/guanylyl cyclase family. There are two forms of guanylate cyclase, a soluble form (GCS or sGC), which act as receptors for nitric oxide and a membrane-bound receptor form (GC), which are peptide hormone receptors. The GC-C protein is composed of an extracellular domain, a single transmembrane domain, and a cytoplasmic region consisting of a kinase-like domain and a catalytic domain. It is expressed as two differentially glycosylated forms, a 130 kDa precursor form present in the endoplasmic reticulum and a 145 kDa form present on the plasma membrane. Ligand binding to the extracellular domain of GC-C promotes the accumulation of cGMP. GC-C acts as the receptor for heatstable enterotoxins, small peptides secreted by some pathogenic strains of E. coli that cause severe secretory diarrhea. GC-C also binds to guanylin and uroguanylin peptides, which modulate renal function in response to oral salt load.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q02108
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2982
Name Human GUCY1A3 (aa 237-306) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200016O07Rik; 4.6.1.2; alpha 1 sGC; GC-SA3; GCSalpha1; GC-S-alpha-1; GCS-alpha1; GCS-alpha-1; GCS-alpha-3; guanylate cyclase 1 soluble subunit alpha; guanylate cyclase 1, soluble, alpha 3; Guanylate cyclase soluble alpha 1 (GTP pyrophosphate - lyase); Guanylate cyclase soluble subunit alpha-1; Guanylate cyclase soluble subunit alpha-3; Guanylate cyclase, soluble, alpha 1 (GTP pyrophosphate - lyase); GUC1A3; GUCA3; GUCSA3; Gucy1a1; GUCY1A3; MYMY6; SGC; sGC-alpha1; soluble guanylate cyclase large subunit
Common Name GUCY1A3
Gene Symbol GUCY1A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato