Invitrogen™ Human GTPBP3 (aa 60-155) Control Fragment Recombinant Protein

Product Code. 30181440

Brand: Invitrogen™ RP99071

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59895 (PA5-59895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described.

Specifications

• Accession Number: Q969Y2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84705
• Name: Human GTPBP3 (aa 60-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410009F13Rik; AI607903; COXPD23; GTP binding protein 3; GTP binding protein 3 (mitochondrial); GTPBG3; GTP-binding protein 3; Gtpbp3; Mitochondrial GTP-binding protein 1; MSS1; MTGP1; THDF1; tRNA modification GTPase GTPBP3, mitochondrial
• Common Name: GTPBP3
• Gene Symbol: GTPBP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining