Invitrogen™ Human GTF2H2 (aa 235-309) Control Fragment Recombinant Protein

Product Code. 30204431

Brand: Invitrogen™ RP104829

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65462 (PA5-65462. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Initiation of transcription from protein-coding genes in eukaryotes is a complex process that requires RNA polymerase II, as well as families of basal transcription factors. Binding of the factor TFIID (TBP) to the TATA box is believed to be the first step in the formation of a multiprotein complex containing several additional factors, including TFIIA, TFIIB, TFIIE, TFIIF and TFII. TFIIH (or BTF2) is a multisubunit transcription/DNA repair factor that possesses several enzymatic activities. The core of TFIIH is composed of five subunits, designated p89 (XPB or ERCC3), p62, p52, p44 and p34. Additional subunits of the TFIIH complex are p80 (XPD or ERCC2) and the ternary kinase complex composed of Cdk7, cyclin H and MAT1. Both p89 and p80 have ATP-dependent helicase activity. The p62, p52 and p44 subunits have been shown to be involved in nucleotide excision repair.

Specifications

• Accession Number: Q13888
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2966
• Name: Human GTF2H2 (aa 235-309) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 44 kDa; basal transcription factor 2, p44 subunit; basic transcription factor 2 44 kDa subunit; BTF2; BTF2 p44; BTF2P44; BTF2-p44; general transcription factor II H, polypeptide 2; general transcription factor II H, polypeptide 2 (44 kDa subunit); general transcription factor IIH polypeptide 2; General transcription factor IIH subunit 2; general transcription factor IIH, polypeptide 2; general transcription factor IIH, polypeptide 2 (44 kDa subunit); general transcription factor IIH, polypeptide 2, 44 kD subunit; general transcription factor IIH, polypeptide 2, 44 kDa; Gtf2h2; p44; T-BTF2P44; TFIIH; TFIIH basal transcription factor complex p44 subunit
• Common Name: GTF2H2
• Gene Symbol: Gtf2h2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining