Invitrogen™ Human GSTZ1 (aa 115-216) Control Fragment Recombinant Protein

Product Code. 30211144

Brand: Invitrogen™ RP89124

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52088 (PA5-52088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms.

Specifications

• Accession Number: O43708
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2954
• Name: Human GSTZ1 (aa 115-216) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17 b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; ABAD; AB-binding alcohol dehydrogenase; amyloid-beta peptide binding alcohol dehydrogenase; CAMR; DUPXp11.22; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; glutathione S-transferase alpha 3; glutathione S-transferase zeta 1; glutathione transferase zeta 1; glutathione transferase zeta 1 (maleylacetoacetate isomerase); GSTZ1; GSTZ1-1; HADH2; HCD2; HSD17B10; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MAAI; MAI; Maleylacetoacetate isomerase; maleylacetone isomerase; MHBD; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MR x 17; MR x 31; MRXS10; S-(hydroxyalkyl)glutathione lyase; SCHAD; SDR5C1; Short chain dehydrogenase/reductase family 5 C member 1; short chain dehydrogenase/reductase family 5 C, member 1; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; XH98G2
• Common Name: GSTZ1
• Gene Symbol: GSTZ1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining