Invitrogen™ Human GSTP1 (aa 76-135) Control Fragment Recombinant Protein

Product Code. 30197779

Brand: Invitrogen™ RP92373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.

Specifications

• Accession Number: P09211
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2950
• Name: Human GSTP1 (aa 76-135) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Chain 7; deafness, X-linked 7; DFN7; epididymis secretory protein Li 22; FAEES3; fatty acid ethyl ester synthase III; glutathione S-transferase P; Glutathione S-transferase P 1; glutathione S-transferase pi 1; glutathione S-transferase pi 2; glutathione S-transferase, pi 1; glutathione S-transferase, pi 2; Glutathione-S-transferase placental enzyme pi type; glutathione-S-transferase, pi 1; Glutathione-S-transferase, placental enzyme pi type; GST 7-7; GST class-pi; gst P1; Gst p-1; GST YF-YF; Gst3; Gstp; GST-P; Gstp1; GSTP1-1; Gstp2; GstpiB; GST-piB; HEL-S-22; HGNC:4638; PI; Preadipocyte growth factor
• Common Name: GSTP1
• Gene Symbol: Gstp1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining