Invitrogen™ Human GSTM3 (aa 164-214) Control Fragment Recombinant Protein

Product Code. 30212465

Brand: Invitrogen™ RP95123

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57191 (PA5-57191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutathione S-transferase M3 (brain), also known as GSTM3, is an enzyme which in humans is encoded by theGSTM3 gene. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13. 3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins.

Specifications

• Accession Number: P21266
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2947
• Name: Human GSTM3 (aa 164-214) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: brain GST; brain type mu-glutathione S-transferase; Fsc2; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; glutathione S-aryltransferase M3; glutathione S-transferase GT9.3; glutathione S-transferase M3 (brain); glutathione S-transferase Mu 3; glutathione S-transferase mu 3 (brain); glutathione S-transferase, mu 3; glutathione S-transferase, Mu-3; GST class-mu 3; GST5; GSTB; GSTM3; GSTM3-3; GTM3; hGSTM3-3; mGSTM5; S-(hydroxyalkyl)glutathione lyase M3
• Common Name: GSTM3
• Gene Symbol: GSTM3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining