Invitrogen™ Human GRWD1 (aa 269-345) Control Fragment Recombinant Protein

Product Code. 30206200

Brand: Invitrogen™ RP105021

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84263 (PA5-84263. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a glutamate-rich protein that contains five WD-repeat motifs. The encoded protein may play a critical role in ribosome biogenesis and may also play a role in histone methylation through interactions with CUL4-DDB1 ubiquitin E3 ligase.

Specifications

• Accession Number: Q9BQ67
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83743
• Name: Human GRWD1 (aa 269-345) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A301; AI504353; CDW4; CUL4- and DDB1-associated WDR protein 4; glutamate rich WD repeat containing 1; glutamate rich WD repeat protein GRWD; glutamate-rich WD repeat containing 1; glutamate-rich WD repeat-containing protein 1; Grwd; GRWD1; KIAA1942; Protein A301; regulator of ribosome biogenesis 1 homolog; RRB1; WD repeat domain 28; WDR28
• Common Name: GRWD1
• Gene Symbol: GRWD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WSPTENTVFASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining