Invitrogen™ Human GRP94 (aa 282-392) Control Fragment Recombinant Protein

Product Code. 30195500

Brand: Invitrogen™ RP102270

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRP94 is a 803 amino acid protein belonging to the heat shock protein 90 family. It acts as a molecular chaperone that functions in the processing and transport of secreted proteins. GRP94 and its N-terminal fragment stimulates CTL expansion and maturation of human monocyte-derived dendritic cells (MDDC). It plays a central role in innate as well as acquired immunity, maturation and chemotaxis of dendritic cells, Ab production, cross-priming, as a potential marker in breast cancer and is a peptide acceptor in endoplasmic reticulum and an accessory to peptide loading of MHC class I molecules. Expression of GRP94 suppressed A23187-induced apoptosis and stabilized calcium homeostasis. GRP94 is expressed in melanoma or liver metastases of colon carcinoma cells, human gastric carcinoma BGC-823 cells.

Specifications

• Accession Number: P14625
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7184
• Name: Human GRP94 (aa 282-392) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 108 K heat shock protein; 108 K HSP; 94 kDa glucose-regulated protein; 94 kDa glucose-regulated protein {ECO:0000250; 98 kDa protein kinase; ecgp; endoplasmic reticulum resident protein 99; Endoplasmin; endoplasmin {ECO:0000250; endoplasmin-like protein; endothelial cell (HBMEC) glycoprotein; epididymis luminal protein 35; epididymis secretory sperm binding protein Li 125 m; ERp99; glucose-regulated protein; glucose-regulated protein GRP94; glucose-regulated protein GRP94 precursor; GP96; gp96 homolog; gp96/GRP94; GRP94; GRP-94; heat shock 108 kDa protein; heat shock protein 108; heat shock protein 108.; heat shock protein 90 beta family member 1; heat shock protein 90 kDa beta member 1; heat shock protein 90 kDa beta member 1 {ECO:0000250; heat shock protein 90, beta (Grp94), member 1; heat shock protein 90, beta, member 1; heat shock protein 90 kDa beta (Grp94), member 1; heat shock protein 90 kDa beta family member 1; heat shock protein 90 kDa beta family member 1 L homeolog; heat shock protein 90 kDa beta, member 1; heat shock protein gp96; HEL35; HEL-S-125 m; HSP 108; hsp108; HSP90 beta; hsp90b1; hsp90b1 {ECO:0000250; hsp90b1.L; Polymorphic tumor rejection antigen 1; PPK 98; Ppk 98; a protein kinase; ppk98; stress-inducible tumor rejection antigen gp96; TA-3; Targ2; tra1; Tra-1; transferrin-binding protein; transforming growth factor alpha regulated gene 2; tumor rejection antigen; tumor rejection antigen (gp96) 1; tumor rejection antigen 1; Tumor rejection antigen gp96; UniProtKB:P08113}; XELAEV_18017384mg
• Common Name: GRP94
• Gene Symbol: HSP90B1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining