Invitrogen™ Human GRK5 (aa 97-153) Control Fragment Recombinant Protein

Product Code. 30199828

Brand: Invitrogen™ RP106137

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111247 (PA5-111247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRK5 is a serine/threonine kinase that regulates the activity of a variety of G protein-coupled receptors and the motility of polymorphonuclear leukocytes. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes.

Specifications

• Accession Number: P34947
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11476, 2869
• Name: Human GRK5 (aa 97-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200003L19Rik; Alpha-CP4; AlphaCP-4; FP2025; G protein-coupled receptor kinase 5; G protein-coupled receptor kinase GRK5; Gprk5; GRK; Grk5; GRK5 protein kinase; GRK-pan; Pan-GRK; Pcbp4; poly(rC) binding protein 4; poly(rC)-binding protein 4
• Common Name: GRK5
• Gene Symbol: GRK5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining