Invitrogen™ Human GRINA (aa 113-164) Control Fragment Recombinant Protein

Product Code. 30195153

Brand: Invitrogen™ RP96581

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57897 (PA5-57897. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transmembrane BAX inhibitor motif (TMBIM) family of proteins includes the founder member TMBIM6/BI-1, TMBIM1/RECS1 (responsive to centrifugal force and shear stress gene 1 protein), TMBIM2/LFG (life guard), TMBIM3/GRINA (glutamate receptor ionotropic NMDA protein 1), TMBIM4/GAAP (Golgi anti-apoptotic-associated protein), and TMBIM5/GHTIM (growth hormone-inducible transmembrane protein). They are highly conserved in mammals and zebrafish and contain a conserved BAX inhibitor-1 motif. GRINA is expressed in the brain and is a potential apoptotic regulator.

Specifications

• Accession Number: Q7Z429
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2907
• Name: Human GRINA (aa 113-164) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110025J15Rik; Glutamate [NMDA] receptor-associated protein 1; glutamate ionotropic receptor NMDA type subunit associated protein 1; glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding); glutamate receptor, NMDA subtype, glutamate-binding subunit; GRINA; HNRGW; Lag; LFG1; NMDA receptor glutamate-binding chain; NMDA receptor glutamate-binding subunit; Nmdara1; N-methyl-D-aspartate receptor glutamate-binding chain; Protein lifeguard 1; putative MAPK-activating protein PM02; TMBIM3; transmembrane BAX inhibitor motif containing 3; transmembrane BAX inhibitor motif-containing protein 3
• Common Name: GRINA
• Gene Symbol: GRINA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining