Invitrogen™ Human GRIK5 (aa 210-297) Control Fragment Recombinant Protein

Product Code. 30193982

Brand: Invitrogen™ RP108628

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. Grik5, also known as kainate-preferring glutamate recptor subunit KA2, belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. Grik5 is highly homologous to the related ionotrophic glutamate receptor Grik4 (also known as KA1). Like Grik4, Grik5 does not form homomeric channels, but instead forms heteromers with Grik2. In Grik2- but not Grik1-null mice, Grik5 surface expression is greatly reduced in neurons, indicating that Grik2/Grik5 heteromers are required for exit from the endoplasmic reticulum to the cell surface.

Specifications

• Accession Number: Q16478
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2901
• Name: Human GRIK5 (aa 210-297) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EAA2; Excitatory amino acid receptor 2; GluK5; GluR gamma-2; GluRgamma2; glutamate ionotropic receptor kainate type subunit 5; glutamate receptor; glutamate receptor gamma-2; Glutamate receptor ionotropic, kainate 5; glutamate receptor KA2; glutamate receptor KA-2; glutamate receptor, ionotropic kainate 5; glutamate receptor, ionotropic, kainate 5; glutamate receptor, ionotropic, kainate 5 (gamma 2); GRIK2; GRIK5; iGlu5; KA2; LOW QUALITY PROTEIN: glutamate receptor ionotropic, kainate 5; MGC128958 protein
• Common Name: GRIK5
• Gene Symbol: GRIK5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining