missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GRB10 (aa 11-104) Control Fragment Recombinant Protein

Product Code. 30196420
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196420

Brand: Invitrogen™ RP105867

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRB7, a SH2 domain protein, has a single SH2 domain at its C-terminal, a central region with similarity to Ras GAP, and a proline-rich N terminus. A related SH2 domain-containing protein, GRB10, exhibits a high degree of homology with GRB7. GRB10 undergoes serine but not tyrosine phosphorylation in response to EGF treatment, but appears to bind to the EGF receptor poorly. GRB10 maps to mouse chromosome 11, in close proximity to the EGF receptor. Similarly, GRB7 maps to the same mouse chromosome near the EGF receptor-related protein HER2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13322
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2887
Name Human GRB10 (aa 11-104) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730571D09Rik; AI325020; Grb10; Grb-10; GRB10 adapter protein; GRB10 adaptor protein; GRBIR; GRB-IR; growth factor receptor bound protein 10; growth factor receptor-bound protein 10; Insulin receptor-binding protein Grb-IR; IRBP; KIAA0207; maternally expressed gene 1; maternally expressed gene 1 protein; Meg1; mKIAA0207; OTTHUMP00000197988; OTTHUMP00000197989; OTTHUMP00000197990; OTTHUMP00000197991; OTTHUMP00000197993; OTTHUMP00000197994; RGD1566234; RSS
Common Name GRB10
Gene Symbol GRB10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.