Invitrogen™ Human GRASP (aa 51-108) Control Fragment Recombinant Protein

Product Code. 30196621

Brand: Invitrogen™ RP107123

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66448 (PA5-66448. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRASP (General receptor for phosphoinositides 1-associated scaffold protein) plays a role in intracellular trafficking and contributes to the macromolecular organization of group 1 metabotropic glutamate receptors (mGluRs) at synapses, linking receptors to neuronal proteins.This protein contains conserved domains, including a leucine zipper sequence, PDZ domain and a C-terminal PDZ-binding motif.

Specifications

• Accession Number: Q7Z6J2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 160622
• Name: Human GRASP (aa 51-108) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 95 kDa postsynaptic density protein discs-large ZO-1 domain-containing protein; general receptor for phosphoinositides 1 associated scaffold protein; general receptor for phosphoinositides 1-associated scaffold protein; grasp; GRASP-1; graspl; GRIP1; GRIP-1; GRIPAP1; GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein; GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein like; Grp1 (general receptor for phosphoinositides)-associated scaffold protein; GRP1-associated scaffold protein; hypothetical protein LOC558950; KIAA1167; LOW QUALITY PROTEIN: general receptor for phosphoinositides 1-associated scaffold protein; MNCb-4428; protein TAMALIN; PSD-95 PDZ domain-containing protein; Tamalin; trafficking regulator and scaffold protein tamalin; zgc:136876
• Common Name: GRASP
• Gene Symbol: GRASP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PADELYAALEDYHPAELYRALAVSGGTLPRRKGSGFRWKNLSQSPEQQRKVLTLEKED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining