Invitrogen™ Human GRAP2 (aa 134-283) Control Fragment Recombinant Protein

Product Code. 30212874

Brand: Invitrogen™ RP91360

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82217 (PA5-82217. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist.

Specifications

• Accession Number: O75791
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9402
• Name: Human GRAP2 (aa 134-283) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adapter protein GRID; Gads; GADS protein; Grap2; GRAP-2; GRB2L; GRB-2-like protein; GRB2-related adapter protein 2; Grb2-related adaptor downstream of Sch; GRB2-related adaptor protein 2; GRB-2-related monocytic adapter protein; GRB2-related protein with insert domain; GRBLG; GRBX; Grf40; grf-40; Grf40 adapter protein; GRID; Growth factor receptor-binding protein; growth factor receptor-bound protein 2-related adaptor protein 2; GrpL; Hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; MONA; monocytic adapter; monocytic adaptor; P38; Protein GADS; RP3-370M22.1; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule
• Common Name: GRAP2
• Gene Symbol: Grap2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining