Invitrogen™ Human Granzyme M Control Fragment Recombinant Protein

Product Code. 30213200

Brand: Invitrogen™ RP90596

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53345 (PA5-53345. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cleaves peptide substrates after methionine, leucine, and norleucine. Physiological substrates include EZR, alpha- tubulins and the apoptosis inhibitor BIRC5/Survivin. Promotes caspase activation and subsequent apoptosis of target cells.

Specifications

• Accession Number: P51124
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3004
• Name: Human Granzyme M Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: granzyme M; granzyme M (lymphocyte met-ase 1); GZMM; Hu-Met-1; Lmet1; lymphoctye Met-ase 1; lymphocyte met-ase 1; MET1; Met-1 serine protease; Met-ase; MMET-1; natural killer cell granular protease; RNK-Met-1
• Common Name: Granzyme M
• Gene Symbol: GZMM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining