Invitrogen™ Human Granzyme K (aa 87-148) Control Fragment Recombinant Protein

Product Code. 30206505

Brand: Invitrogen™ RP109096

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144884 (PA5-144884. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Granzyme K (GrK) belongs to a family of trypsin-like serine proteases localised in the cytotoxic granules of activated T cells and NK cells. It encodes a 28 kDa serine protease whose gene is located on chromosome 5q11-12 close to the granzyme A-encoding gene. Like granzyme A, it has a trypsin-like specifity cleaving at the basic residues arginine and lysine. Granzyme K triggers rapid cell death independently of caspase activation with single-stranded DNA nicks and is primarily expressed in thymus, lung, spleen and peripheral blood leukocytes.

Specifications

• Accession Number: P49863
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3003
• Name: Human Granzyme K (aa 87-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Fragmentin-3; granzyme 3; granzyme K; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme-3; GrK; GZMK; NK-Tryp-2; NK-tryptase-2; RNK-Tryp-2; TRYP2; tryptase II
• Common Name: Granzyme K
• Gene Symbol: GZMK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining