Invitrogen™ Human Granzyme H (aa 97-243) Control Fragment Recombinant Protein

Product Code. 30201401

Brand: Invitrogen™ RP88868

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83074 (PA5-83074. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14.

Specifications

• Accession Number: P20718
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2999
• Name: Human Granzyme H (aa 97-243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cathepsin G-like 2; cathepsin G-like 2, protein h-CCPX; CCP-X; CGL2; CGL-2; CSP-C; CTLA1; CTSGL2; Cytotoxic serine protease C; Cytotoxic T-lymphocyte proteinase; cytotoxic T-lymphocyte-associated serine esterase 1; cytotoxin serine protease-C; granzyme H; granzyme H (cathepsin G-like 2, protein h-CCPX); GZMH
• Common Name: Granzyme H
• Gene Symbol: GZMH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining