Invitrogen™ Human Granzyme A (aa 209-260) Control Fragment Recombinant Protein

Product Code. 30204592

Brand: Invitrogen™ RP109589

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.

Specifications

• Accession Number: P12544
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3001
• Name: Human Granzyme A (aa 209-260) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Autocrine thymic lymphoma granzyme-like serine protease; AW494114; BLT esterase; CTL tryptase; CTLA3; CTLA-3; Cytotoxic T-lymphocyte proteinase 1; Cytotoxic T-lymphocyte-associated serine esterase-3; fragmentin-1; granzyme 1; granzyme A; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); Granzyme-1; GZMA; H factor; Hanukah factor; Hanukah factor serine protease); Hanukkah factor; Hf; HFSP; Mtsp-1; SE1; serine esterase 1; t cell-specific serine protease 1; TSP1; TSP-1
• Common Name: Granzyme A
• Gene Symbol: GZMA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining