missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211387

Invitrogen™ Human GPX8 Control Fragment Recombinant Protein

Product Code. 30211387
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211387

Brand: Invitrogen™ RP104143

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57787 (PA5-57787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPX8 (Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TED1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 493869
Name Human GPX8 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310016C16Rik; AU017063; EPLA847; glutathione peroxidase 8; glutathione peroxidase 8 (putative); GPX8; GPx-8; GSHPx-8; probable glutathione peroxidase 8; RGD1307506; UNQ847; UNQ847/PRO1785
Common Name GPX8
Gene Symbol GPX8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.