Invitrogen™ Human GPX4 (aa 124-196) Control Fragment Recombinant Protein

Product Code. 30210264

Brand: Invitrogen™ RP104833

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83862 (PA5-83862. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Specifications

• Accession Number: P36969
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2879
• Name: Human GPX4 (aa 124-196) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: glutathione peroxidase 4; GP-GPx4; Gpx4; gpx-4; GSHPx-4; HGNC:4556; MCSP; mtPHGPx; Phgpx; phospholipid hydroperoxidase; phospholipid hydroperoxide glutathione peroxidase; phospholipid hydroperoxide glutathione peroxidase, mitochondrial; phospholipid hydroperoxide glutathione peroxidase, nuclear; SMDS; snGPx; snPHGPx; sperm nuclei glutathione peroxidase; sperm nucleus glutathione peroxidase
• Common Name: GPX4
• Gene Symbol: GPX4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining