missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GPSM2 (aa 499-599) Control Fragment Recombinant Protein

Product Code. 30200043
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200043

Brand: Invitrogen™ RP89660

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52555 (PA5-52555. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to a family of proteins that modulate activation of G proteins, which transduce extracellular signals received by cell surface receptors into integrated cellular responses. The N-terminal half of this protein contains 10 copies of leu-gly-asn repeat, and the C-terminal half contains 4 GoLoco motifs, which are involved in guanine nucleotide exchange. This protein may play a role in neuroblast division and in the development of normal hearing. Mutations in this gene are associated with autosomal recessive nonsyndromic deafness.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P81274
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29899
Name Human GPSM2 (aa 499-599) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6230410J09Rik; CMCS; DFNB82; G protein signaling modulator 2; G-protein signaling modulator 2; G-protein signaling modulator 2 (AGS3-like, C. elegans); G-protein signalling modulator 2 (AGS3-like, C. elegans); G-protein-signaling modulator 2; GPSM2; HGNC:29501; hypothetical protein MGC63574; LGN; LGN protein; Mosaic protein LGN; Pins; Pins homolog; pins homolog (Drosophia); Pinsa; RGD1560967; TPR-motif and GoLoco-motif containing protein; zgc:63574
Common Name GPSM2
Gene Symbol GPSM2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.