Invitrogen™ Human GPSM2 (aa 499-599) Control Fragment Recombinant Protein

Product Code. 30200043

Brand: Invitrogen™ RP89660

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52555 (PA5-52555. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to a family of proteins that modulate activation of G proteins, which transduce extracellular signals received by cell surface receptors into integrated cellular responses. The N-terminal half of this protein contains 10 copies of leu-gly-asn repeat, and the C-terminal half contains 4 GoLoco motifs, which are involved in guanine nucleotide exchange. This protein may play a role in neuroblast division and in the development of normal hearing. Mutations in this gene are associated with autosomal recessive nonsyndromic deafness.

Specifications

• Accession Number: P81274
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29899
• Name: Human GPSM2 (aa 499-599) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6230410J09Rik; CMCS; DFNB82; G protein signaling modulator 2; G-protein signaling modulator 2; G-protein signaling modulator 2 (AGS3-like, C. elegans); G-protein signalling modulator 2 (AGS3-like, C. elegans); G-protein-signaling modulator 2; GPSM2; HGNC:29501; hypothetical protein MGC63574; LGN; LGN protein; Mosaic protein LGN; Pins; Pins homolog; pins homolog (Drosophia); Pinsa; RGD1560967; TPR-motif and GoLoco-motif containing protein; zgc:63574
• Common Name: GPSM2
• Gene Symbol: GPSM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining