Invitrogen™ Human GPSM1 (aa 387-454) Control Fragment Recombinant Protein

Product Code. 30182035

Brand: Invitrogen™ RP98515

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59911 (PA5-59911. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal activity of G-protein signaling systems. The protein contains seven tetratricopeptide repeats in its N-terminal half and four G-protein regulatory (GPR) motifs in its C-terminal half. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q86YR5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26086
• Name: Human GPSM1 (aa 387-454) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810037C22Rik; Activator of G-protein signaling 3; Ags3; AW107933; C10a; DKFZP727I051; G-protein signaling modulator 1; G-protein signaling modulator 1 (AGS3-like, C. elegans); G-protein signalling modulator 1 (AGS3-like, C. elegans); G-protein-signaling modulator 1; Gpsm1
• Common Name: GPSM1
• Gene Symbol: GPSM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining