missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197587

Invitrogen™ Human GPR98 (aa 2669-2812) Control Fragment Recombinant Protein

Product Code. 30197587
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197587

Brand: Invitrogen™ RP107583

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84761 (PA5-84761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the G-protein coupled receptor superfamily. The encoded protein contains a 7-transmembrane receptor domain, binds calcium and is expressed in the central nervous system. Mutations in this gene are associated with Usher syndrome 2 and familial febrile seizures. Several alternatively spliced transcripts have been described.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WXG9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84059
Name Human GPR98 (aa 2669-2812) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4-Feb; ADGRV1; ADGRV1 subunit alpha; ADGRV1 subunit beta; adhesion G protein-coupled receptor V1; Adhesion G-protein coupled receptor V1; FEB4; Frings; G protein-coupled receptor 98; Gpr98; G-protein coupled receptor 98; KIAA0686; KIAA1943; MASS1; Mgr1; monogenic; monogenic audiogenic seizure susceptibility protein 1; monogenic audiogenic seizure susceptibility protein 1 homolog; monogenic, audiogenic seizure susceptibility 1; monogenic, audiogenic seizure susceptibility 1 homolog; neurepin; USH2B; USH2C; Usher syndrome type-2 C protein; very large G protein-coupled receptor 1; very large G-protein coupled receptor 1; VLGR1; VLGR1b
Common Name GPR98
Gene Symbol ADGRV1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.