Invitrogen™ Human GPR41 (aa 286-343) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30205378	100 μL	100µL

Product Code. 30205378 Supplier Invitrogen™ Supplier No. RP100019

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60791 (PA5-60791. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a role in many different stimulus-response pathways. GPRs translate extracellular signals into intracellular signals (a process called G-protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters. GPR41 (G-protein coupled receptor 41), also known as FFAR3 (Free fatty acid receptor 3), is a 346 amino acid multi-pass membrane protein that belongs to the G protein-coupled receptor family. Expressed at high levels in adipose tissue and at lower levels throughout the body, GPR41 functions as a receptor for short chain fatty acids via elevation of intracellular calcium levels and inhibition of adenylyl cyclase.

Specifications

• Accession Number: O14843
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2865
• Name: Human GPR41 (aa 286-343) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FFA3R; FFAR3; Free fatty acid receptor 3; G protein-coupled receptor 41; Gm478; Gpcr41; GPR41; GPR42; G-protein coupled receptor 41; putative G protein-coupled receptor GPR41
• Common Name: GPR41
• Gene Symbol: FFAR3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVAC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining