missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210647

Invitrogen™ Human GPR37L1 (aa 35-86) Control Fragment Recombinant Protein

Product Code. 30210647
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210647

Brand: Invitrogen™ RP103771

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111582 (PA5-111582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This polyclonal antibody was raised in Rabbit against GPR37L1. This antibody is unconjugated. This antibody is useful for testing in the following assays: IHC-P. The specificity of this antibody has been described as follows: Human GPR37L1. BLAST analysis of the peptide immunogen showed no homology with other human proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60883
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9283
Name Human GPR37L1 (aa 35-86) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW047233; CAG-18; D0Kist8; Endothelin B receptor-like protein 2; endothelin B receptor-like protein-2; endothelin type b receptor-like protein 2; ET(B)R-LP-2; ETBRLP2; ETBR-LP-2; G protein-coupled receptor 37 like 1; G protein-coupled receptor 37-like 1; G protein-coupled receptor 37-lke 1; GPCR/CNS2; GPR37L1; G-protein coupled receptor 37 like 1; G-protein coupled receptor 37-like 1; orphan Gpr37-like protein 1; prosaposin receptor GPR37L1
Common Name GPR37L1
Gene Symbol GPR37L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.