Invitrogen™ Human GPR37 (aa 185-260) Control Fragment Recombinant Protein

Codice prodotto. 30200369

Marca: Invitrogen™ RP103995

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Parkinson is the second most common neurodegenerative disease after Alzheimers. About 1 percent of people over the age of 65 and 3 percent of people over the age of 75 are affected by the disease. The mutation is the most common cause of Parkinson disease identified to date. The function of Park2 is not well-known; however, it may play a role in the ubiquitin-mediated proteolytic pathway. Mutations in this gene are known to cause autosomal recessive juvenile parkinsonism. Alternative splicing of this gene produces three known products of undetermined function. Panneuronal expression of Parkin substrate Pael-R causes age-dependent selective degeneration of Drosophila dopaminergic (DA) neurons; coexpression of Parkin degrades Pael-R and suppresses its toxicity.

Specifica

• Accession Number: O15354
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2861
• Name: Human GPR37 (aa 185-260) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI848630; EDNRBL; endothelin B receptor-like protein 1; ETBR-LP-1; G protein-coupled receptor 37; G protein-coupled receptor 37 (endothelin receptor type B-like); Gpcr/cns1; Gpr37; G-protein coupled receptor 37; G-protein coupled receptor CNS1; hET(B)R-LP; Het-b-r-lp; Pael receptor; PAELR; Pael-R; parkin-associated endothelin B-like receptor; Parkin-associated endothelin receptor-like receptor; probable G-protein coupled receptor 37; prosaposin receptor GPR37
• Common Name: GPR37
• Gene Symbol: GPR37
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining