Invitrogen™ Human GPR161 (aa 406-525) Control Fragment Recombinant Protein

Product Code. 30210032

Brand: Invitrogen™ RP90868

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Upon ligand binding, G protein-coupled receptors, such as GPR161, activate cytoplasmic G proteins (see GNAS, MIM 139320), allowing the receptors to transduce extracellular signals across the plasma membrane into the cell.

Specifications

• Accession Number: Q8N6U8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23432
• Name: Human GPR161 (aa 406-525) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ33952; G protein-coupled receptor 161; Gm208; Gm208Gpr; Gpr161; G-protein coupled receptor 161; G-protein coupled receptor RE2; RE2; RGD1563245; Unknown (protein for MGC:134300); vl
• Common Name: GPR161
• Gene Symbol: GPR161
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining