Invitrogen™ Human GPR156 (aa 717-814) Control Fragment Recombinant Protein

Product Code. 30211505

Brand: Invitrogen™ RP95163

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55928 (PA5-55928. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors (GPCRs) are a large superfamily of cell surface receptors characterized by 7 helical transmembrane domains, together with N-terminal extracellular and C-terminal intracellular domains.[supplied by OMIM, Mar 2008].

Specifications

• Accession Number: Q8NFN8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 165829
• Name: Human GPR156 (aa 717-814) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor 156; G protein-coupled receptor PGR28; GABABL; GABAB-related G-protein coupled receptor; GPR156; G-protein coupled receptor PGR28; PGR28; Probable G-protein coupled receptor 156
• Common Name: GPR156
• Gene Symbol: GPR156
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPDLPEQWQLWPPVPSGCASLSSQHSYFDTESSSSDEFFCRCHRPYCEICFQSSSDSSDSGTSDTDPEPTGGLASWEKLWARSKPIVNFKDDLKPTLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining