Invitrogen™ Human GPR142 (aa 24-83) Control Fragment Recombinant Protein

Product Code. 30210761

Brand: Invitrogen™ RP95326

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56726 (PA5-56726. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPR142 is a member of the rhodopsin family of G protein-coupled receptors.

Specifications

• Accession Number: Q7Z601
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 350383
• Name: Human GPR142 (aa 24-83) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor 142; GPR142; G-protein coupled receptor PGR2; PGR2; Probable G-protein coupled receptor 142
• Common Name: GPR142
• Gene Symbol: GPR142
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFRQAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining