Invitrogen™ Human GPR139 (aa 288-344) Control Fragment Recombinant Protein

Product Code. 30208105

Brand: Invitrogen™ RP95164

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111239 (PA5-111239. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Orphan receptor that seems to act through a G(q/11)-mediated pathway.

Specifications

• Accession Number: Q6DWJ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124274
• Name: Human GPR139 (aa 288-344) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor 139; G protein-coupled receptor PGR3; g(q)-coupled orphan receptor GPRg1; Gm495; Gpr139; GPRG1; G-protein coupled receptor 139; G-protein-coupled receptor PGR3; orphan G protein-coupled receptor TRHRL2; PGR3; Probable G-protein coupled receptor 139
• Common Name: GPR139
• Gene Symbol: GPR139
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining