Invitrogen™ Human GPR137B (aa 314-399) Control Fragment Recombinant Protein

Product Code. 30202150

Brand: Invitrogen™ RP89571

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110915 (PA5-110915. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPRs are characterized by the presence of 7 transmembrane domains. G Protein-Coupled Receptor (GPCR) TM7SF1 is a member of this family (subfamily: orphan U) and its expression has been reported in adult kidney and heart, but not in fetal kidney.

Specifications

• Accession Number: O60478
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7107
• Name: Human GPR137B (aa 314-399) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor 137 B; GPR137B; Integral membrane protein GPR137B; RP5-985L19.1; TM7SF1; transmembrane 7 superfamily member 1 (upregulated in kidney); transmembrane 7 superfamily member 1 protein
• Common Name: GPR137B
• Gene Symbol: GPR137B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining