Invitrogen™ Human GPR114 (aa 22-170) Control Fragment Recombinant Protein

Product Code. 30197903

Brand: Invitrogen™ RP89579

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52390 (PA5-52390. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the adhesion family of G-protein coupled receptors. Members of this family are characterized by long N-termini and multiple functional domains. They may play a role in the immune system as well as in the central nervous system. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q8IZF4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221188
• Name: Human GPR114 (aa 22-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADGRG5; adhesion G protein-coupled receptor G5; adhesion G-protein coupled receptor G5; G protein-coupled receptor 114; G protein-coupled receptor PGR27; GPR114; G-protein coupled receptor 114; G-protein coupled receptor PGR27; PGR27; probable G-protein coupled receptor 114; UNQ2524/PRO6017
• Common Name: GPR114
• Gene Symbol: ADGRG5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining