Invitrogen™ Human GPR107 Control Fragment Recombinant Protein

Product Code. 30205443

Brand: Invitrogen™ RP95651

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56822 (PA5-56822. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPR107 also named as KIAA1624 or LUSTR1 is 600 amino acid protein, which belongs to the LU7TM family. GPR107 localizes in membrane and is a multi-pass membrane protein. GPR107 is a promising candidate receptor for neuronostatin, and neuronostatin, interacting with GPR107, may play an important role in the central control of cardiovascular function.

Specifications

• Accession Number: Q5VW38
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57720
• Name: Human GPR107 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9930033D15Rik; AI790205; bA138E2.2; C530034M11; G protein-coupled receptor 107; GCDRP; Gpr107; KIAA1624; Lung seven transmembrane receptor 1; LUSTR1; mKIAA1624; Protein GPR107
• Common Name: GPR107
• Gene Symbol: Gpr107
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining