missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GPLD1 (aa 256-367) Control Fragment Recombinant Protein

Product Code. 30203231
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203231

Brand: Invitrogen™ RP102400

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52941 (PA5-52941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPLD1 is expressed in numerous tissues and cells and specifically cleaves GPI-anchored proteins. Liver has the highest level of GPI-PLD expression and is the primary organ contributing to GPLD1 in the serum. GPLD1 is abundant in serum in which it associates with polipoproteins AI and AIV. Increased serum GPLD1 is associated with insulin resistance and elevated serum triglycerides. Many surface proteins are attached to eukaryotic cell membranes via glycosylphosphatidylinositol (GPI) anchors that are covalently bound to the C-terminus of the protein and cleavage of the GPI moiety by GPLD1, only enzyme known that cleavage GPI anchor, may represent a means of regulating attachment of these proteins to the cell surface, or alternatively, their release into the extracellular environment.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P80108
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2822
Name Human GPLD1 (aa 256-367) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330541J12Rik; AW546131; glycoprotein phospholipase D; glycosylphosphatidylinositol phospholipase D; glycosylphosphatidylinositol specific phospholipase D1; glycosylphosphatidylinositol specific phospholipase D1, isoform 2; Glycosyl-phosphatidylinositol-specific phospholipase D; GPIPLD; GPI-PLD; GPIPLDM; GPI-specific phospholipase D; Gpld1; MGC22590; Phosphatidylinositol-glycan-specific phospholipase D; PI-G PLD; PIGPLD; PIGPLD1; PLD
Common Name GPLD1
Gene Symbol GPLD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.