Invitrogen™ Human GPKOW (aa 56-161) Control Fragment Recombinant Protein

Product Code. 30212611

Brand: Invitrogen™ RP91888

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51374 (PA5-51374. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a putative RNA-binding protein containing G-patch and KOW (Kyprides, Ouzounis, Woese) domains. The encoded protein interacts directly with protein kinase A and protein kinase X and is also found associated with the spliceosome.

Specifications

• Accession Number: Q92917
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27238
• Name: Human GPKOW (aa 56-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4432411B18; DXErtd697e; DXImx41e; G patch domain and KOW motifs; G patch domain and KOW motifs-containing protein; GPATC5; G-patch domain and KOW motifs; G-patch domain and KOW motifs-containing protein; G-patch domain-containing protein 5; GPATCH5; GPKOW; Protein MOS2 homolog; Protein T54; Spp2; T54
• Common Name: GPKOW
• Gene Symbol: GPKOW
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining