Invitrogen™ Human GPATCH8 (aa 314-407) Control Fragment Recombinant Protein

Product Code. 30194022

Brand: Invitrogen™ RP93525

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60694 (PA5-60694. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The GPATCH8 protein contains an RNA-processing domain, a zinc finger domain, a lysine-rich region and a serine-rich region. A mutation in the serine-rich region of the protein is thought to be associated with hyperuricemia (PMID: 21594610). Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9UKJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23131
• Name: Human GPATCH8 (aa 314-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430405G24Rik; AU018890; ENSMUSG00000075516; Fbm1; Fyn-binding molecule 1; G patch domain containing 8; G patch domain-containing protein 8; Gpatc8; G-patch domain containing 8; GPATCH8; KIAA0553; mKIAA0553
• Common Name: GPATCH8
• Gene Symbol: GPATCH8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SIASVFKDHAEEGTSEDGTKPDEKSSDQGLQKVGDSDGSSNLDGKKEDEDPQDGGSLASTLSKLKRMKREEGAGATEPEYYHYIPPAHCKVKPN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining