Invitrogen™ Human GPATCH2 (aa 273-373) Control Fragment Recombinant Protein

Product Code. 30212328

Brand: Invitrogen™ RP94053

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55536 (PA5-55536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The gene encodes a nuclear factor that may play a role in spermatogenesis and in tumor growth during breast cancer. The encoded protein contains a G-patch domain with an RNA binding motif. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9NW75
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55105
• Name: Human GPATCH2 (aa 273-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830433G22Rik; 5830436K05Rik; AI427714; AI447508; AW107440; AW491060; cancer/testis antigen 110; CT110; G patch domain containing 2; G patch domain-containing protein 2; GPATC2; G-patch domain containing 2; GPATCH2; PPP1R30; protein phosphatase 1, regulatory subunit 30; RP11-361K17.1; si:ch211-57i17.3; si:ch73-21k16.4
• Common Name: GPATCH2
• Gene Symbol: GPATCH2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMVPIPGPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining