Invitrogen™ Human GPATCH1 (aa 340-435) Control Fragment Recombinant Protein

Product Code. 30213116

Brand: Invitrogen™ RP109755

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145069 (PA5-145069. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9BRR8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55094
• Name: Human GPATCH1 (aa 340-435) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300003A17Rik; ECGP; evolutionarily conserved G patch domain containing; evolutionarily conserved G-patch domain containing; evolutionarily conserved G-patch domain-containing protein; G patch domain containing 1; G patch domain-containing protein 1; GPATC1; G-patch domain containing 1; Gpatch1
• Common Name: GPATCH1
• Gene Symbol: GPATCH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RYVGKILDGFSLASKPLSSKKIYPPPELPRDYRPVHYFRPMVAATSENSHLLQVLSESAGKATPDPGTHSKHQLNASKRAELLGETPIQGSATSVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining