Invitrogen™ Human GOT2 (aa 149-211) Control Fragment Recombinant Protein

Product Code. 30210586

Brand: Invitrogen™ RP109845

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GOT2 is a glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Specifications

• Accession Number: P00505
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2806
• Name: Human GOT2 (aa 149-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL022787; aspartate aminotransferase 2; aspartate aminotransferase precursor (EC 2.6.1.1); aspartate aminotransferase, mitochondrial; aspartate transaminase 2; ASPATA; FABP-1; FABPpm; FABP-pm; fatty acid-binding protein; FLJ40994; Glutamate oxaloacetate transaminase 2; glutamate oxaloacetate transaminase 2, mitochondrial; Glutamate oxaloacetate transaminase 2, mitochondrial (aspartate aminotransferase 2); glutamatic-oxaloacetic transaminase 2, mitochondrial; glutamic-oxaloacetic transaminase 2; glutamic-oxaloacetic transaminase 2, mitochondrial; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); GOT2; Got-2; KAT4; KATIV; KYAT4; kynurenine aminotransferase 4; Kynurenine aminotransferase IV; kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; Maat; mAspAT; mitAAT; mitochondrial aspartate aminotransferase; plasma membrane fatty acid binding protein; plasma membrane-associated fatty acid-binding protein; Transaminase A
• Common Name: GOT2
• Gene Symbol: GOT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining